Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger protein 225 (RN225), partial, Biotinylated

This Recombinant Human RING finger protein 225 (RN225), partial, Biotinylated spans the amino acid sequence from region 1-202. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RING finger protein 225 RNF225

UniProt

M0QZC1

Expression Region

1-202

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPCPRPFWLRHSRAPQGSGPSSPGSLSAPRSPSRGEDQEEEEEEEGDGSPGSGPILPPASPVECLICVSSFDGVFKLPKRLDCGHVFCLECLARLSLATAGGGNAVACPVCRAPTRLAPRRGLPALPTQSGLLPRDARAPPSRQGSVRFDRRRGLLYLRPPPPPPGPRKARAPPPPPPLRLGRPLSRRLSLASPAWVFNAAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD62L antibody
MO62LF(V500) 500 µg

CD62L antibody

Sign In for Pricing
View Details
HELB Lentiviral Activation Particles (m)
sc-431192-LAC 200 µL

HELB Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
E-Selectin Mouse mAb, Cy3 conjugated
orb2837991 100 µL

E-Selectin Mouse mAb, Cy3 conjugated

Sign In for Pricing
View Details
pENTR223-DNAJB11 vector Plasmid
PVT12050 2 µg

pENTR223-DNAJB11 vector Plasmid

Sign In for Pricing
View Details
Osteocalcin, CT (Gamma-carboxyglutamic Acid-containing Protein, Bone Gla-protein, BGP, BGLAP) (PE) discontinued
O8060-25C-PE 200 µL

Osteocalcin, CT (Gamma-carboxyglutamic Acid-containing Protein, Bone Gla-protein, BGP, BGLAP) (PE) discontinued

Sign In for Pricing
View Details
Neuritin (NRN1) Human shRNA Plasmid Kit (Locus ID 51299)
TR319032 1 Kit

Neuritin (NRN1) Human shRNA Plasmid Kit (Locus ID 51299)

Sign In for Pricing
View Details