Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 18 (SIM18), partial, Biotinylated

This Recombinant Human Small integral membrane protein 18 (SIM18), partial, Biotinylated spans the amino acid sequence from region 56-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 18 SMIM18

UniProt

P0DKX4

Expression Region

56-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YEVLDCCCCVKNKTVKDLKSEPNPLRSMMDNIRKRETEVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Didox
C5499-10 10 mg

Didox

Sign In for Pricing
View Details
PerCP Anti-human CD56 Antibody *B-A19*
105601T0-AAT 25 Tests

PerCP Anti-human CD56 Antibody *B-A19*

Sign In for Pricing
View Details
Slco1c1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7123803 1.0 µg DNA

Slco1c1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
F box and leucine rich repeat gene 4 Antibody
79-639 0.1 mg

F box and leucine rich repeat gene 4 Antibody

Sign In for Pricing
View Details
KIF19 (NM_153209) Human Over-expression Lysate
LS124602-100ug 100 µg

KIF19 (NM_153209) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Regulator of microtubule dynamics protein 2 (RMDN2) ELISA Kit
abx542901 96 Tests

Human Regulator of microtubule dynamics protein 2 (RMDN2) ELISA Kit

Sign In for Pricing
View Details