Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 18 (SIM18), partial, Biotinylated

This Recombinant Human Small integral membrane protein 18 (SIM18), partial, Biotinylated spans the amino acid sequence from region 56-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 18 SMIM18

UniProt

P0DKX4

Expression Region

56-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YEVLDCCCCVKNKTVKDLKSEPNPLRSMMDNIRKRETEVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SIPA1L2 Antibody [DyLight 680]
NBP1-77090FR 0.1 mL

Rabbit Polyclonal SIPA1L2 Antibody [DyLight 680]

Sign In for Pricing
View Details
Nutrient Agar 2Kg
211665 1 Each

Nutrient Agar 2Kg

Sign In for Pricing
View Details
Quick Step Human Crimean-Congo hemorrhagic fever virus IgG (CCHF-IgG) elisa Kit
QS2434Hu-01 48 Tests

Quick Step Human Crimean-Congo hemorrhagic fever virus IgG (CCHF-IgG) elisa Kit

Sign In for Pricing
View Details
Quick Step Human Crimean-Congo hemorrhagic fever virus IgG (CCHF-IgG) elisa Kit
QS2434Hu-02 96 Tests

Quick Step Human Crimean-Congo hemorrhagic fever virus IgG (CCHF-IgG) elisa Kit

Sign In for Pricing
View Details
Lentiviral mouse Rab38 shRNA (UAS) - Lentiviral mouse Rab38 shRNA (UAS, GFP) plasmid
GTR15274690 1 Vial

Lentiviral mouse Rab38 shRNA (UAS) - Lentiviral mouse Rab38 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
CD70 Antibody
V3034-100UG 100 µg

CD70 Antibody

Sign In for Pricing
View Details