Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich protein 23D2 (P23D2), Biotinylated

This Recombinant Human Proline-rich protein 23D2 (P23D2), Biotinylated spans the amino acid sequence from region 1-279. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proline-rich protein 23D2 PRR23D2

UniProt

P0DMB1

Expression Region

1-279

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYGYRRLRSPRDSQTEPQNDNEGETSLATTQMNPPKRRQVEQGPSTGAKKPSISGAPHLNSYQSLELPQNQQDSGTEELMIVLEQGTEVRLSLEEVILILAPETVLQLTLENTVLVIVPEHVLRSEDGLQSPVQIQYIIPSVDDFSLEFHAQDGDISDMRRENVPFSPAEEGKAAPLYQQPLMIPQANHMAGISPSFLVTPLCIPRCRAAFPQCYPLPPTPSPVGRPRPADSSFSLHGMELLCTSSLRPMPPSPSPGPQVYHRVHHRPPSRARRCLFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZBTB7A shRNA (UAS) - Lentiviral human ZBTB7A shRNA (UAS) plasmid
GTR15146527 1 Vial

Lentiviral human ZBTB7A shRNA (UAS) - Lentiviral human ZBTB7A shRNA (UAS) plasmid

Sign In for Pricing
View Details
H mgN5 Antibody
E51A12728 100 µL

H mgN5 Antibody

Sign In for Pricing
View Details
Lentiviral human RGS17 shRNA (UAS) - Lentiviral human RGS17 shRNA (UAS) plasmid
GTR15086311 1 Vial

Lentiviral human RGS17 shRNA (UAS) - Lentiviral human RGS17 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Absolute Mag™ Alkyne Magnetic Nanoparticles, Dextran Coated, 250 nm
WHM-G252 10 mL

Absolute Mag™ Alkyne Magnetic Nanoparticles, Dextran Coated, 250 nm

Sign In for Pricing
View Details
CD36 Protein (C-His, Mouse)
P520786 100 µg

CD36 Protein (C-His, Mouse)

Sign In for Pricing
View Details
Rabbit Dehydroepiandrosterone sulfate ELISA Kit
MBS722687-01 48 Well

Rabbit Dehydroepiandrosterone sulfate ELISA Kit

Sign In for Pricing
View Details