Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C8orf88 (CH088), Biotinylated

This Recombinant Human Uncharacterized protein C8orf88 (CH088), Biotinylated spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C8orf88 C8orf88

UniProt

P0DMB2

Expression Region

1-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCKTNGMQAFSQGLNEQQQQQSPVKKERIKYSRDFLLKLSSVSICRKKPDFLPDHPIVLQKPENNQSFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN13 antibody
FNab09056 100 µg

TSPAN13 antibody

Sign In for Pricing
View Details
IL1RA (IL1RN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E8]
TA803484BM 100 µL

IL1RA (IL1RN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E8]

Sign In for Pricing
View Details
NR2C1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D11]
TA803354BM 100 µL

NR2C1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D11]

Sign In for Pricing
View Details
1-[(2S)-2-Amino-1-oxo-3-phenylpropyl]pyrrolidine
TRC-A618760-250MG 250 mg

1-[(2S)-2-Amino-1-oxo-3-phenylpropyl]pyrrolidine

Sign In for Pricing
View Details
Cyclophilin F (PPIF) Rabbit Monoclonal Antibody [Clone ID: R02-6I9]
TA385023 100 µL

Cyclophilin F (PPIF) Rabbit Monoclonal Antibody [Clone ID: R02-6I9]

Sign In for Pricing
View Details
Monkey IgG (H&L) Antibody
TA398079 1 mg

Monkey IgG (H&L) Antibody

Sign In for Pricing
View Details