Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial, Biotinylated

This Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial, Biotinylated spans the amino acid sequence from region 57-153. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative transmembrane protein INAFM2; InaF-motif-containing protein 2; Osteogenesis up-regulated transcript 1; INAFM2 LINC00984 OGU1

UniProt

P0DMQ5

Expression Region

57-153

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YSLIWQPVGAGTSGGAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAPPEPPADSPPAGPLERPRGPDEDEEETAAAPGSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MDA5 Antibody [Alexa Fluor 700]
NBP1-76761AF700 0.1 mL

Rabbit Polyclonal MDA5 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
NQO1 antibody
70R-12504 100 µL

NQO1 antibody

Sign In for Pricing
View Details
GFOD1 Double Nickase Plasmid (m2)
sc-435887-NIC-2 20 µg

GFOD1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
TRNAG12 Protein Vector (Human) (pPB-C-His)
PV138822 500 ng

TRNAG12 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) DEOB Polyclonal Antibody
MBS7175105 Inquire

Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) DEOB Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Cd3e activation kit by CRISPRa
GA200622 1 Kit

Mouse Cd3e activation kit by CRISPRa

Sign In for Pricing
View Details