Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C1GALT1-specific chaperone 1-like protein (C1C1L), partial, Biotinylated

This Recombinant Human C1GALT1-specific chaperone 1-like protein (C1C1L), partial, Biotinylated spans the amino acid sequence from region 30-315. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1GALT1-specific chaperone 1-like protein C1GALT1C1L

UniProt

P0DN25

Expression Region

30-315

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HIRHRGQTQDHEHHHLRPPNRNDFLNTSKVILLELSKSIRVFCIIFGESEDESYWAVLKETWTKHCDKAELYDTKNDNLFNIESNDRWVQMRTAYKYVFEKYGDNYNWFFLALPTTFAVIENLKYLLFTRDASQPFYLGHTVIFGDLEYVTVEGGIVLSRELMKRLNRLLDNSETCADQSVIWKLSEDKQLAICLKYAGVHAENAEDYEGRDVFNTKPIAQLIEEALSNNPQQVVEGCCSDMAITFNGLTPQKMEVMMYGLYRLRAFGHYFNDTLVFLPPVGSEND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPD2 Antibody
E38PA3765 100 µL

AMPD2 Antibody

Sign In for Pricing
View Details
GPRC6A Lentiviral Activation Particles (h)
sc-403492-LAC 200 µL

GPRC6A Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Glucocorticoid Receptor/GR discontinued
317307 100 µL

Glucocorticoid Receptor/GR discontinued

Sign In for Pricing
View Details
Pkia 3'UTR GFP Stable Cell Line
TU166443 1.0 mL

Pkia 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Phospho-Cdc25B (S353)
328453-01 50 µg

Phospho-Cdc25B (S353)

Sign In for Pricing
View Details
Phospho-Cdc25B (S353)
328453-02 100 µg

Phospho-Cdc25B (S353)

Sign In for Pricing
View Details