Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 225B (T225B), partial, Biotinylated

This Recombinant Human Transmembrane protein 225B (T225B), partial, Biotinylated spans the amino acid sequence from region 168-221. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 225B TMEM225B

UniProt

P0DP42

Expression Region

168-221

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CLIQEMVCPCWHLLSTSQSMEEDHGSLYLDNLESLGGEPSSVQKETQVTAETVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TissueScan, Prostate Cancer cDNA Array III
HPRT303 5 Panels

TissueScan, Prostate Cancer cDNA Array III

Sign In for Pricing
View Details
MDM2 (SMP14), CF568 conjugate, 0.1mg/mL
BNC681721-100 1x 100 µL

MDM2 (SMP14), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TSPAN3 (NM_001168412) Human Over-expression Lysate
LC432654 20 µg

TSPAN3 (NM_001168412) Human Over-expression Lysate

Sign In for Pricing
View Details
PGAM1 (NM_002629) Human Over-expression Lysate
LC400934 20 µg

PGAM1 (NM_002629) Human Over-expression Lysate

Sign In for Pricing
View Details
VOPP1 (NM_030796) Human Recombinant Protein
TP321464 20 µg

VOPP1 (NM_030796) Human Recombinant Protein

Sign In for Pricing
View Details
Sterol carrier protein 2 (SCP2) (NM_001193599) Human Over-expression Lysate
LC434294 20 µg

Sterol carrier protein 2 (SCP2) (NM_001193599) Human Over-expression Lysate

Sign In for Pricing
View Details