Recombinant Human Putative uncharacterized protein MED14OS (M14OS), Biotinylated
This Recombinant Human Putative uncharacterized protein MED14OS (M14OS), Biotinylated spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Putative uncharacterized protein MED14OS; MED14 antisense gene protein 1; MED14 opposite strand protein; MED14OS MED14-AS1
UniProt
P0DP75
Expression Region
1-135
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MRSSSLPGARSPRRNGSGQSRHRLPPGRLRTGSRAPTAEARPHVARSPPTPGTGARGGGRRGWGGSRAAPQRGSCASANAQKQLRQTAATYMLTARGGSRSAERKGDLQRTFRQVGQTMPMVPPLDFTMNAASVE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KCA16977-01 50 mg
5,6,7,8-Tetrahydroquinoline-8-carbonitrile hydrochloride
Sign In for Pricing
View Details KCA16977-02 0.5 g
5,6,7,8-Tetrahydroquinoline-8-carbonitrile hydrochloride
Sign In for Pricing
View Details RQ7423 100 µg
SBDS Antibody / Shwachman-Bodian-Diamond syndrome protein
Sign In for Pricing
View Details 
TL320780V 500 µL Each
KRTAP5-5 Human shRNA Lentiviral Particle (Locus ID 439915)
Sign In for Pricing
View Details LV762271 1.0 µg DNA
GMCL1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details