Recombinant Human Putative uncharacterized protein MED14OS (M14OS), Biotinylated
This Recombinant Human Putative uncharacterized protein MED14OS (M14OS), Biotinylated spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Putative uncharacterized protein MED14OS; MED14 antisense gene protein 1; MED14 opposite strand protein; MED14OS MED14-AS1
UniProt
P0DP75
Expression Region
1-135
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MRSSSLPGARSPRRNGSGQSRHRLPPGRLRTGSRAPTAEARPHVARSPPTPGTGARGGGRRGWGGSRAAPQRGSCASANAQKQLRQTAATYMLTARGGSRSAERKGDLQRTFRQVGQTMPMVPPLDFTMNAASVE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
FT203A0785 Pack of 100
Pack of 100 board filter discs 390g/m², 785 mm
Sign In for Pricing
View Details C11651 100 µL
p130 Cas (Phospho-Tyr410) Polyclonal Conjugated Antibody
Sign In for Pricing
View Details 
251036-Biotin 100 µL
REG1A (Regenerating Islet-Derived 1 alpha, ICRF, MGC12447, P19, PSP, PSPS, PSPS1, PTP, REG) (Biotin)
Sign In for Pricing
View Details NBP2-74477AF488 0.1 mL
Mouse Monoclonal TCP11L2 Antibody (OTI2A10) [Alexa Fluor 488]
Sign In for Pricing
View Details 