Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 723 (ZN723), Biotinylated

This Recombinant Human Zinc finger protein 723 (ZN723), Biotinylated spans the amino acid sequence from region 1-513. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 723 ZNF723

UniProt

P0DPD5

Expression Region

1-513

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGPLTFTDVAIKFSLEEWQFLDTAQQNLYRDVMLENYRNLVFLGVGVSKPDLITCLEQGKEPWNMKRHKMVAKPPVVCSHFAQDLWPEQGIKDSFQKVILRSYGKYGHDNLQLRKGCESVDECKMHKGGYDELKQCLTTTPSKIFQCDKYVKVFHKFSSSNSQKIRHTGNNSFKCKECGKSFCMLSHLTKHERNHTRVNCYKCEECGKAFSVPSKLNNHKRIHTGEKPYKCEECGKAFNVSSSLNNHKRIHTGEKPYKCEECGKTFNMFSSLNNHKRIHTGEKPYKCKECGKAFNVFSSLNNHKRIHTGEKPYKCEECGKAFNQPSHLATHKRIHTGEKLYKCEECGKAFSQSSHITTHKRIHTGEKPYKCEECGKAFKVSVHLTTHKRIHTGEKPYKCEECGKAFNQSSALTTHKIIHTGERPYKCKQCGKGFSQSSTLTKHKIIHTKEKPYKCEECGKAFNQYSTLNKHKIIHAREKPYKCEECGKAFNKSSILNRHKIIHTKEKSQTLKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-COX5A Antibody, Affinity Purified
MBS3905699-01 0.01 mg

Rabbit anti-COX5A Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-COX5A Antibody, Affinity Purified
MBS3905699-02 0.1 mg

Rabbit anti-COX5A Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-COX5A Antibody, Affinity Purified
MBS3905699-03 5x 0.01 mg

Rabbit anti-COX5A Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-COX5A Antibody, Affinity Purified
MBS3905699-04 5x 0.1 mg

Rabbit anti-COX5A Antibody, Affinity Purified

Sign In for Pricing
View Details
PMEPA1 CRISPR/Cas9 KO Plasmid (m)
sc-425757 20 µg

PMEPA1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
C18orf26 AAV Vector (Human) (CMV)
14031101 1 µg

C18orf26 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details