Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial, Biotinylated

This Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial, Biotinylated spans the amino acid sequence from region 149-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative taste receptor type 2 member 33; T2R33; hGR33; TAS2R33

UniProt

P0DSN6

Expression Region

149-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Others Antibody
orb3131520-01 1 mg

Others Antibody

Sign In for Pricing
View Details
Others Antibody
orb3131520-02 5 mg

Others Antibody

Sign In for Pricing
View Details
Porcine Glucosidase Alpha, Neutral C ELISA Kit
MBS7271225-01 48 Well

Porcine Glucosidase Alpha, Neutral C ELISA Kit

Sign In for Pricing
View Details
Porcine Glucosidase Alpha, Neutral C ELISA Kit
MBS7271225-02 96 Well

Porcine Glucosidase Alpha, Neutral C ELISA Kit

Sign In for Pricing
View Details
Porcine Glucosidase Alpha, Neutral C ELISA Kit
MBS7271225-03 5x 96 Well

Porcine Glucosidase Alpha, Neutral C ELISA Kit

Sign In for Pricing
View Details
Porcine Glucosidase Alpha, Neutral C ELISA Kit
MBS7271225-04 10x 96 Well

Porcine Glucosidase Alpha, Neutral C ELISA Kit

Sign In for Pricing
View Details