Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E14 (SPD14), Biotinylated

This Recombinant Human Speedy protein E14 (SPD14), Biotinylated spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E14 SPDYE14

UniProt

P0DUD3

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RC74 (INTS9) activation kit by CRISPRa
GA110942 1 Kit

Human RC74 (INTS9) activation kit by CRISPRa

Sign In for Pricing
View Details
KLF2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F1]
TA807006AM 100 µL

KLF2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F1]

Sign In for Pricing
View Details
DUSP23 (NM_017823) Human Over-expression Lysate
LC402621 20 µg

DUSP23 (NM_017823) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: right middle lobe
CS648057 5x 5 µm

Frozen Tissue Sections, Lung: right middle lobe

Sign In for Pricing
View Details
RCC2 Rabbit Polyclonal Antibody
TA380811 100 µL

RCC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Slc20a2 Mouse Gene Knockout Kit (CRISPR)
KN515920 1 Kit

Slc20a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details