Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E18 (SPD18), Biotinylated

This Recombinant Human Speedy protein E18 (SPD18), Biotinylated spans the amino acid sequence from region 1-352. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E18 SPDYE18

UniProt

P0DV79

Expression Region

1-352

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDRTKTRFRKRGQITGKITTSRQPHPQNEQSLQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSPILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEDPKQNIFYFLYGKTRSRIPLVRNRRFQLCRCLNPRARKNRSQIALFQKLRFQFFCSMSGRAWVSREELEEIQAYDPEHWVWARDRARLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AATOM™ 565 acid
2827-AAT 25 mg

AATOM™ 565 acid

Sign In for Pricing
View Details
Uncoated Human Cys-C (Cystatin C) ELISA Kit
E-UNEL-H0035-01 5x 96 Tests

Uncoated Human Cys-C (Cystatin C) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human Cys-C (Cystatin C) ELISA Kit
E-UNEL-H0035-02 15x 96 Tests

Uncoated Human Cys-C (Cystatin C) ELISA Kit

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF647 conjugate, 0.1mg/mL
BNC471602-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Twist1 Mouse Gene Knockout Kit (CRISPR)
KN318498 1 Kit

Twist1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTP kappa (PTPRK) Human Gene Knockout Kit (CRISPR)
KN217570 1 Kit

PTP kappa (PTPRK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details