Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Golgin subfamily A member 6-like protein 26 (GG6LZ), Biotinylated

This Recombinant Human Golgin subfamily A member 6-like protein 26 (GG6LZ), Biotinylated spans the amino acid sequence from region 1-649. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Golgin subfamily A member 6-like protein 26 GOLGA6L26

UniProt

P0DX02

Expression Region

1-649

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MWPQPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTTSGGCHSPEDEQKASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTKERDALSLELYRNTITDEELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADHLGKELQSVSAKLQAQVEENELWNRLNQQQEEKMWRQEEKIQEWEEKIQEQEEKIREQEEKIREQEEKMRRQEEMMWEKEEKMRRQEEMMWEKEEKMRRLEEMMWEKEEKIRELEEKMHEQEKIREQEEKRQEEEKIREQEKRQEQEAKMWRQEEKIREQEEKIREQEKKMWRQEEKIHEQEKIREEEKRQEQEEMWRQEEKIREQEEIWRQKEKMHEQEKIRKQEEKVWRQEEKMHDQEEKIREQEEKMWRQEEKIREQEEKIREQEEKIREQEEKIREQEEMMQEQEEKMGEQEEKMQEQEKMRRQEEKIREQEEKIREQKEKIREQEEKIWEQEEKIREQEEMMQEQEEKMWEQEEKMCEQEEKMQEQEEKMRRQEEKMWEQEVRLRQQEEKMQEHQEHLEAAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-100 1x 100 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-500 1x 500 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2643), CF640R conjugate, 0.1mg/mL
BNC402643-100 1x 100 µL

Prolactin (Pituitary Tumor Marker) (PRL/2643), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF647 conjugate, 0.1mg/mL
BNC471906-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053 + L1C1), CF594 conjugate, 0.1mg/mL
BNC940755-100 1x 100 µL

Human Kappa Light Chain (HP6053 + L1C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details