Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-15C (TB15C), Biotinylated

This Recombinant Human Thymosin beta-15C (TB15C), Biotinylated spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymosin beta-15C TMSB15C

UniProt

P0DX04

Expression Region

2-45

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propan-2-yl 2-Sulfanylacetate
TRC-B524470-250MG 250 mg

Propan-2-yl 2-Sulfanylacetate

Sign In for Pricing
View Details
RPL24 (NM_000986) Human Over-expression Lysate
LC424416 20 µg

RPL24 (NM_000986) Human Over-expression Lysate

Sign In for Pricing
View Details
D,L-Alpha-Hydroxy Myristic Acid
TRC-H948500-10MG 10 mg

D,L-Alpha-Hydroxy Myristic Acid

Sign In for Pricing
View Details
Human SYT10 activation kit by CRISPRa
GA117515 1 Kit

Human SYT10 activation kit by CRISPRa

Sign In for Pricing
View Details
IgM Immunoglobulin (Cocktail), 0.2mg/mL
BNUB0762-500 1x 500 µL

IgM Immunoglobulin (Cocktail), 0.2mg/mL

Sign In for Pricing
View Details
CDK2 Mouse Monoclonal Antibody [Clone ID: 1A6]
AM06741PU-N 100 µg

CDK2 Mouse Monoclonal Antibody [Clone ID: 1A6]

Sign In for Pricing
View Details