Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative chemokine-related protein B42 (CCB42), Biotinylated

This Recombinant Human Putative chemokine-related protein B42 (CCB42), Biotinylated spans the amino acid sequence from region 1-81. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative chemokine-related protein B42

UniProt

Q1T7F1

Expression Region

1-81

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPLSDWCCGICEEAPLGRAYTQTWMETGCGPHGVTALGQQELKDCLRARSGGTASSVDWIMEAARGSLNVHNCLIKFGRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO25 3'UTR GFP Stable Cell Line
TU057789 1.0 mL

FBXO25 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PENK 3'UTR GFP Stable Cell Line
TU067731 1.0 mL

PENK 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Integrin beta 1 (ITGB1) (NM_133376) Human Tagged ORF Clone Lentiviral Particle
RC215247L3V 200 µL

Integrin beta 1 (ITGB1) (NM_133376) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Anti Human CASP10 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul
IRBAHUCASP10AP820200UL 200 µL

Rabbit Anti Human CASP10 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul

Sign In for Pricing
View Details
Daprodustat Impurity 30
RM-D012030-01 10 mg

Daprodustat Impurity 30

Sign In for Pricing
View Details
Daprodustat Impurity 30
RM-D012030-02 25 mg

Daprodustat Impurity 30

Sign In for Pricing
View Details