Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1), Biotinylated

This Recombinant Human Testis development-related protein 1 (TDRG1), Biotinylated spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rhof (NM_175092) AAV Particle
MR202289A1V 250 µL

Mouse Rhof (NM_175092) AAV Particle

Sign In for Pricing
View Details
Dextran Axonal Tracer 10,000 MW, CF®790 Conjugate
81-1022 1 mg

Dextran Axonal Tracer 10,000 MW, CF®790 Conjugate

Sign In for Pricing
View Details
F8 (6D1) Rabbit Monoclonal Antibody
E28M1901 100 µL

F8 (6D1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MRVI1 Lentiviral Activation Particles (m2)
sc-421712-LAC-2 200 µL

MRVI1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
OREX Antibody
C45345-01 50 μL

OREX Antibody

Sign In for Pricing
View Details
OREX Antibody
C45345-02 100 µL

OREX Antibody

Sign In for Pricing
View Details