Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1), Biotinylated

This Recombinant Human Testis development-related protein 1 (TDRG1), Biotinylated spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shewanella amazonensis Na (+)/H (+) antiporter nhaB, partial
MBS1260514-01 1 mg (E-Coli)

Recombinant Shewanella amazonensis Na (+)/H (+) antiporter nhaB, partial

Sign In for Pricing
View Details
Recombinant Shewanella amazonensis Na (+)/H (+) antiporter nhaB, partial
MBS1260514-02 1 mg (Yeast)

Recombinant Shewanella amazonensis Na (+)/H (+) antiporter nhaB, partial

Sign In for Pricing
View Details
Glutathione S-Transferase P (GSTP1) Antibody
abx102866-01 100 µL

Glutathione S-Transferase P (GSTP1) Antibody

Sign In for Pricing
View Details
Glutathione S-Transferase P (GSTP1) Antibody
abx102866-02 200 µL

Glutathione S-Transferase P (GSTP1) Antibody

Sign In for Pricing
View Details
Glutathione S-Transferase P (GSTP1) Antibody
abx102866-03 1 mL

Glutathione S-Transferase P (GSTP1) Antibody

Sign In for Pricing
View Details
NCAPG2
325298-01 50 µL

NCAPG2

Sign In for Pricing
View Details