Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lens epithelial cell protein LEP503 (LENEP), Biotinylated

This Recombinant Human Lens epithelial cell protein LEP503 (LENEP), Biotinylated spans the amino acid sequence from region 1-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lens epithelial cell protein LEP503 LENEP LEP503

UniProt

Q9Y5L5

Expression Region

1-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQPRTQPLAQTLPFFLGGAPRDTGLRVPVIKMGTGWEGFQRTLKEVAYILLCCWCIKELLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMPPE Antibody - N-terminal region (ARP44886_P050)
ARP44886_P050 100 µL

TMPPE Antibody - N-terminal region (ARP44886_P050)

Sign In for Pricing
View Details
ELISA Kit For Microtubule-associated proteins 1A/1B light chain 3B
E2880m 96 Tests

ELISA Kit For Microtubule-associated proteins 1A/1B light chain 3B

Sign In for Pricing
View Details
Guinea Pig 5-aminolevulinate synthase, erythroid-specific, mitochondrial (ALAS2) ELISA Kit
GTR10325601 96 Well

Guinea Pig 5-aminolevulinate synthase, erythroid-specific, mitochondrial (ALAS2) ELISA Kit

Sign In for Pricing
View Details
TMLHE Polyclonal Antibody
RD84413A-01 60 μL

TMLHE Polyclonal Antibody

Sign In for Pricing
View Details
TMLHE Polyclonal Antibody
RD84413A-02 120 μL

TMLHE Polyclonal Antibody

Sign In for Pricing
View Details
TMLHE Polyclonal Antibody
RD84413A-03 200 µL

TMLHE Polyclonal Antibody

Sign In for Pricing
View Details