Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary microtubule inner protein 3 (CMIP3), Biotinylated

This Recombinant Human Ciliary microtubule inner protein 3 (CMIP3), Biotinylated spans the amino acid sequence from region 1-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ciliary microtubule inner protein 3; GUCA1A neighbor; CIMIP3 GUCA1ANB

UniProt

X6R8D5

Expression Region

1-112

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCKDSQKPSVPSHGPKTPSCKGVKAPHSSRPRAWKQDLEQSLAAAYVPVVVDSKGQNPDKLRFNFYTSQYSNSLNPFYTLQKPTCGYLYRRDTDHTRKRFDVPPANLVLWRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stefin B (CSTB) (1-98) Mouse Monoclonal Antibody [Clone ID: 2F1]
AM03137PU-S 50 µL

Stefin B (CSTB) (1-98) Mouse Monoclonal Antibody [Clone ID: 2F1]

Sign In for Pricing
View Details
CXCL11 (C-term) Rabbit Polyclonal Antibody
AP51143PU-N 400 µL

CXCL11 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Atxn7l3b Mouse Gene Knockout Kit (CRISPR)
KN501859 1 Kit

Atxn7l3b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
XIAP (NM_001167) Human Recombinant Protein
TP307627M 100 µg

XIAP (NM_001167) Human Recombinant Protein

Sign In for Pricing
View Details
RHEB Polyclonal Antibody
E-AB-16645-01 20 µL

RHEB Polyclonal Antibody

Sign In for Pricing
View Details
RHEB Polyclonal Antibody
E-AB-16645-02 60 µL

RHEB Polyclonal Antibody

Sign In for Pricing
View Details