Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Translation machinery-associated protein 7B (TMA7B), Biotinylated

This Recombinant Human Translation machinery-associated protein 7B (TMA7B), Biotinylated spans the amino acid sequence from region 1-64. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Translation machinery-associated protein 7B TMA7B

UniProt

A0A024R1R8

Expression Region

1-64

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Kim1 Matched Antibody Pair Set [ABP-S-052036]
ABP-S-052036 5 Plates

Rat Kim1 Matched Antibody Pair Set [ABP-S-052036]

Sign In for Pricing
View Details
CDK17 siRNA (Human)
orb1864848-01 15 nmol

CDK17 siRNA (Human)

Sign In for Pricing
View Details
CDK17 siRNA (Human)
orb1864848-02 30 nmol

CDK17 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Mouse Guanylate cyclase activator 2B (Guca2b)
orb3053800-01 20 µg

Recombinant Mouse Guanylate cyclase activator 2B (Guca2b)

Sign In for Pricing
View Details
Recombinant Mouse Guanylate cyclase activator 2B (Guca2b)
orb3053800-02 100 µg

Recombinant Mouse Guanylate cyclase activator 2B (Guca2b)

Sign In for Pricing
View Details
Recombinant Mouse Guanylate cyclase activator 2B (Guca2b)
orb3053800-03 1 mg

Recombinant Mouse Guanylate cyclase activator 2B (Guca2b)

Sign In for Pricing
View Details