Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycine-rich extracellular protein 1 (GREP1), Biotinylated

This Recombinant Human Glycine-rich extracellular protein 1 (GREP1), Biotinylated spans the amino acid sequence from region 23-536. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycine-rich extracellular protein 1; Long intergenic non-protein coding RNA 514; GREP1 LINC00514

UniProt

A0A0J9YXV3

Expression Region

23-536

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLPLLPPGLGKVYGPHSGLGAGYDGGVKPQKPGFVVRHGLGTQPDTEGGMKPQNLGFRTFAGAAAQPGYGNGLGAAAFPVAGAQSGPAAQNGFGPGFGGGGKPQKPGPTTQNGYRPGYVGAVKPQKPGFQYRIGLGAQPGFRGDMKAQEPGLGNGNGLSAQPVLTAQNRFGFGAGLGGNVKPLKPGYGKRLRAGAFPGAGTQPEYGHGNGPGVQPGLGAGMKPQMPGLGAPNGYGPGRGRAGVPGGPERRPWVPHLLPFSSPGYLGVMKAQKPGPLAQNGYRAGAGEGMKPQKPGLRGTLKPQKSGHGHENGPWPGPCNARVAPMLLPRLPTPGVPSDKEGGWGLKSQPPSAVQNGKLPAPMPAIQWGLKPQKAGHQPPNGYGPGAEPGFNGGLEPQKIGLGYGNGVLGARVFPEAHPQPGFHGANGFRNRDGVEALVYPKAAALAPEGNGQAGVLWNSRWPTLQAWGAGLKPGYQAGDEYAEARSQPGGPDVKRGSNGQLGNGYGGRCPLGKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Heat shock cognate 71 kDa protein (Hspa8)
CSB-YP010829MO-01 20 µg

Recombinant Mouse Heat shock cognate 71 kDa protein (Hspa8)

Sign In for Pricing
View Details
Recombinant Mouse Heat shock cognate 71 kDa protein (Hspa8)
CSB-YP010829MO-02 100 µg

Recombinant Mouse Heat shock cognate 71 kDa protein (Hspa8)

Sign In for Pricing
View Details
Recombinant Mouse Heat shock cognate 71 kDa protein (Hspa8)
CSB-YP010829MO-03 1 mg

Recombinant Mouse Heat shock cognate 71 kDa protein (Hspa8)

Sign In for Pricing
View Details
Mouse heme oxygenase 2 (HO-2) ELISA Kit
MBS264382-01 48 Well

Mouse heme oxygenase 2 (HO-2) ELISA Kit

Sign In for Pricing
View Details
Mouse heme oxygenase 2 (HO-2) ELISA Kit
MBS264382-02 96 Well

Mouse heme oxygenase 2 (HO-2) ELISA Kit

Sign In for Pricing
View Details
Mouse heme oxygenase 2 (HO-2) ELISA Kit
MBS264382-03 5x 96 Well

Mouse heme oxygenase 2 (HO-2) ELISA Kit

Sign In for Pricing
View Details