Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LBH domain-containing protein 2 (LBHD2), Biotinylated

This Recombinant Human LBH domain-containing protein 2 (LBHD2), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LBH domain-containing protein 2 LBHD2

UniProt

A0A0U1RRK4

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNL1 Antibody : Biotin (OAAF01897-Biotin)
OAAF01897-100UG-Biotin 100 µg

CCNL1 Antibody : Biotin (OAAF01897-Biotin)

Sign In for Pricing
View Details
Purified anti-mouse CD3
MBS9472790-01 0.1 mg

Purified anti-mouse CD3

Sign In for Pricing
View Details
Purified anti-mouse CD3
MBS9472790-02 1 mg

Purified anti-mouse CD3

Sign In for Pricing
View Details
Purified anti-mouse CD3
MBS9472790-03 5x 1 mg

Purified anti-mouse CD3

Sign In for Pricing
View Details
Recombinant Human Adenosine deaminase/ADA (C-His)
32-10976-500 500 µg

Recombinant Human Adenosine deaminase/ADA (C-His)

Sign In for Pricing
View Details
Zfp534 AAV siRNA Pooled Vector
51017164 1.0 µg

Zfp534 AAV siRNA Pooled Vector

Sign In for Pricing
View Details