Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C3orf85 (CC085), Biotinylated

This Recombinant Human Uncharacterized protein C3orf85 (CC085), Biotinylated spans the amino acid sequence from region 21-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C3orf85 C3orf85

UniProt

A0A1B0GTC6

Expression Region

21-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APFLLEDPANQFLRLKRHVNLQDYWDPDHSSDVWVNTLAKQARETWIALKTTAQYYLDMNTFTFDMSTAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hybrid Grid Box; holds both clipped and unclipped grids
M-CEM-NS-HGB-NL-12 12 Units

Hybrid Grid Box; holds both clipped and unclipped grids

Sign In for Pricing
View Details
ZIC1, NT (ZIC1, ZIC, ZNF201, Zinc finger protein ZIC 1, Zinc finger protein 201, Zinc finger protein of the cerebellum 1) (PE)
MBS6365347-01 0.2 mL

ZIC1, NT (ZIC1, ZIC, ZNF201, Zinc finger protein ZIC 1, Zinc finger protein 201, Zinc finger protein of the cerebellum 1) (PE)

Sign In for Pricing
View Details
ZIC1, NT (ZIC1, ZIC, ZNF201, Zinc finger protein ZIC 1, Zinc finger protein 201, Zinc finger protein of the cerebellum 1) (PE)
MBS6365347-02 5x 0.2 mL

ZIC1, NT (ZIC1, ZIC, ZNF201, Zinc finger protein ZIC 1, Zinc finger protein 201, Zinc finger protein of the cerebellum 1) (PE)

Sign In for Pricing
View Details
Mouse Monoclonal MRP1 Antibody (MRP1/1344) [DyLight 650]
NBP3-08228C 100 µL

Mouse Monoclonal MRP1 Antibody (MRP1/1344) [DyLight 650]

Sign In for Pricing
View Details
Nitromide
orb1226774-01 200 mg

Nitromide

Sign In for Pricing
View Details
Nitromide
orb1226774-02 500 mg

Nitromide

Sign In for Pricing
View Details