Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C3orf85 (CC085), Biotinylated

This Recombinant Human Uncharacterized protein C3orf85 (CC085), Biotinylated spans the amino acid sequence from region 21-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C3orf85 C3orf85

UniProt

A0A1B0GTC6

Expression Region

21-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APFLLEDPANQFLRLKRHVNLQDYWDPDHSSDVWVNTLAKQARETWIALKTTAQYYLDMNTFTFDMSTAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Flexneri argG Protein (aa 2-447)
VAng-Lsx07608-500gEcoli 500 µg (E. coli)

Recombinant Shigella Flexneri argG Protein (aa 2-447)

Sign In for Pricing
View Details
DnaJC10 HDR Plasmid (h)
sc-406274-HDR 20 µg

DnaJC10 HDR Plasmid (h)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Transforming Growth Factor Beta Induced Protein (TGFbI)
MBS2038415-01 0.1 mL

FITC-Linked Polyclonal Antibody to Transforming Growth Factor Beta Induced Protein (TGFbI)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Transforming Growth Factor Beta Induced Protein (TGFbI)
MBS2038415-02 0.2 mL

FITC-Linked Polyclonal Antibody to Transforming Growth Factor Beta Induced Protein (TGFbI)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Transforming Growth Factor Beta Induced Protein (TGFbI)
MBS2038415-03 0.5 mL

FITC-Linked Polyclonal Antibody to Transforming Growth Factor Beta Induced Protein (TGFbI)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Transforming Growth Factor Beta Induced Protein (TGFbI)
MBS2038415-04 1 mL

FITC-Linked Polyclonal Antibody to Transforming Growth Factor Beta Induced Protein (TGFbI)

Sign In for Pricing
View Details