Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stabilizer of axonemal microtubules 3 (SAXO3), Biotinylated

This Recombinant Human Stabilizer of axonemal microtubules 3 (SAXO3), Biotinylated spans the amino acid sequence from region 1-334. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stabilizer of axonemal microtubules 3 SAXO3

UniProt

A0A1B0GTJ6

Expression Region

1-334

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASGTLAPGCRISATEVPGSRPNCHLTSSYFSHRIIPPIPFTPPTVQSTVADPLPQVAKQDSHNWAFDEVLSRWETTSGSAYVPKTHGGPCAQPRAPEPADPTRTVGIKDLGEKLRHRGWRLPLTTKYQSSETRAQYTGSPSGDPRAPEYFGPQPPQLADHHRGGPSQALIAWTKNPELSGRPFTVSDRGVLDRRQLYLTTSARDFRFYPKTELSGYPRKDSLTYWSFEETPQVWSHGPQRPPCPRSSRPPRPPRVRVPRVSPVTSAMPHRGALSLAQESYSPLLHPLRRLDRFCPLEAPWGGPHWKPLRGIYSVPKAYSTENSSYGSLKPALV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details