Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51A (CX05A), Biotinylated

This Recombinant Human Uncharacterized protein CXorf51A (CX05A), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51A CXorf51A CXorf51

UniProt

A0A1B0GTR3

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Transmembrane protein 106B
E4836h 96 Tests

ELISA Kit For Transmembrane protein 106B

Sign In for Pricing
View Details
C9orf156, CT (Nef-associated protein 1, Thioesterase NAP1, HSPC219, NAP1, C9orf156) (MaxLight 650)
MBS6468985-01 0.1 mL

C9orf156, CT (Nef-associated protein 1, Thioesterase NAP1, HSPC219, NAP1, C9orf156) (MaxLight 650)

Sign In for Pricing
View Details
C9orf156, CT (Nef-associated protein 1, Thioesterase NAP1, HSPC219, NAP1, C9orf156) (MaxLight 650)
MBS6468985-02 5x 0.1 mL

C9orf156, CT (Nef-associated protein 1, Thioesterase NAP1, HSPC219, NAP1, C9orf156) (MaxLight 650)

Sign In for Pricing
View Details
Mouse mmu-miR-1933-5p miRNA Agomir
abx883201-01 5 nmol

Mouse mmu-miR-1933-5p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-1933-5p miRNA Agomir
abx883201-02 10 nmol

Mouse mmu-miR-1933-5p miRNA Agomir

Sign In for Pricing
View Details
SPON1 Polyclonal Antibody
MBS9135116-01 0.02 mL

SPON1 Polyclonal Antibody

Sign In for Pricing
View Details