Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51A (CX05A), Biotinylated

This Recombinant Human Uncharacterized protein CXorf51A (CX05A), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51A CXorf51A CXorf51

UniProt

A0A1B0GTR3

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triethylamine, GlenPure™, analytical grade
GS2878-100ml 100 mL

Triethylamine, GlenPure™, analytical grade

Sign In for Pricing
View Details
FKHR (m) : 293 Lysate
sc-178616 100 µg - 200 µL

FKHR (m) : 293 Lysate

Sign In for Pricing
View Details
Phospho-RAF1 (Ser339) Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-5652R-PE-Cy5.5 100 µL

Phospho-RAF1 (Ser339) Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: DX3]
AM08166AC-N 100 Tests

CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: DX3]

Sign In for Pricing
View Details
Mouse Dynactin Subunit 6 (DCTN6) ELISA Kit
abx509884 96 Tests

Mouse Dynactin Subunit 6 (DCTN6) ELISA Kit

Sign In for Pricing
View Details
TTC5 (NM_138376) Human Over-expression Lysate
LC408643 20 µg

TTC5 (NM_138376) Human Over-expression Lysate

Sign In for Pricing
View Details