Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51A (CX05A), Biotinylated

This Recombinant Human Uncharacterized protein CXorf51A (CX05A), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51A CXorf51A CXorf51

UniProt

A0A1B0GTR3

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-UCP2 Antibody Picoband® (FITC Conjugate)
A02256-1-FITC 100 µg/Vial

Anti-UCP2 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
LINC00322 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
26675061 1.0 µg DNA

LINC00322 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Integrin beta 7 Rabbit pAb, BF700 conjugated
orb2889891 100 µL

Integrin beta 7 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
MIR4698 Human qPCR Primer Pair (MI0017331)
HP301090 200 Reactions

MIR4698 Human qPCR Primer Pair (MI0017331)

Sign In for Pricing
View Details
STAT2 Rabbit mAb
E60M1862 100 µL

STAT2 Rabbit mAb

Sign In for Pricing
View Details
Anti-LYN (pY397) Antibody
E38A4712 100 µg -100 µL

Anti-LYN (pY397) Antibody

Sign In for Pricing
View Details