Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51A (CX05A), Biotinylated

This Recombinant Human Uncharacterized protein CXorf51A (CX05A), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51A CXorf51A CXorf51

UniProt

A0A1B0GTR3

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UHRF2, ID (UHRF2, NIRF, RNF107, E3 ubiquitin-protein ligase UHRF2, Np95/ICBP90-like RING finger protein, Nuclear protein 97, Nuclear zinc finger protein Np97, RING finger protein 107, Ubiquitin-like PHD and RING finger domain-containing protein 2, Ubiquitin-like-containing PHD and RING finger domains protein 2) (MaxLight 650) discontinued
043591-ML650 100 µL

UHRF2, ID (UHRF2, NIRF, RNF107, E3 ubiquitin-protein ligase UHRF2, Np95/ICBP90-like RING finger protein, Nuclear protein 97, Nuclear zinc finger protein Np97, RING finger protein 107, Ubiquitin-like PHD and RING finger domain-containing protein 2, Ubiquitin-like-containing PHD and RING finger domains protein 2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
DGCR6, ID (DGCR6, Protein DGCR6, DiGeorge syndrome critical region 6) (MaxLight 550)
MBS6291878-01 0.1 mL

DGCR6, ID (DGCR6, Protein DGCR6, DiGeorge syndrome critical region 6) (MaxLight 550)

Sign In for Pricing
View Details
DGCR6, ID (DGCR6, Protein DGCR6, DiGeorge syndrome critical region 6) (MaxLight 550)
MBS6291878-02 5x 0.1 mL

DGCR6, ID (DGCR6, Protein DGCR6, DiGeorge syndrome critical region 6) (MaxLight 550)

Sign In for Pricing
View Details
2-Chloro-1- (4-chloro-phenyl) -ethanol
OR963832-01 250 mg

2-Chloro-1- (4-chloro-phenyl) -ethanol

Sign In for Pricing
View Details
2-Chloro-1- (4-chloro-phenyl) -ethanol
OR963832-02 5 g

2-Chloro-1- (4-chloro-phenyl) -ethanol

Sign In for Pricing
View Details
Phospho-BRCA1 (Ser1466) Rabbit Polyclonal Antibody (APC-Cy7)
orb2529984 100 µL

Phospho-BRCA1 (Ser1466) Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details