Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 53 (TEX53), Biotinylated

This Recombinant Human Testis-expressed protein 53 (TEX53), Biotinylated spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 53 TEX53

UniProt

A0A1B0GU33

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSKIFCCCRKTSEGSSTTVGFHNPRMFEQHHPRSFNLNTNSLHSAVPKRHPRLPYDNRMMLKACILRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSA (NM_000487) Human Over-expression Lysate
LY424697 100 µg

ARSA (NM_000487) Human Over-expression Lysate

Sign In for Pricing
View Details
Apo Active FITC - Caspase 3 Detection Kit
FAB200-2 100 Tests

Apo Active FITC - Caspase 3 Detection Kit

Sign In for Pricing
View Details
Mouse Dlx6os2 activation kit by CRISPRa
GA201089 1 Kit

Mouse Dlx6os2 activation kit by CRISPRa

Sign In for Pricing
View Details
Parvin gamma (PARVG) (NM_001137605) Human Over-expression Lysate
LY427944 100 µg

Parvin gamma (PARVG) (NM_001137605) Human Over-expression Lysate

Sign In for Pricing
View Details
CF®640R Amine
#92043 1x 1 mg

CF®640R Amine

Sign In for Pricing
View Details
VEGFR2 / Flk-1 / KDR3 / CD309 (KDR721), CF405S conjugate, 0.1mg/mL
BNC040721-100 1x 100 µL

VEGFR2 / Flk-1 / KDR3 / CD309 (KDR721), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details