Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 53 (TEX53), Biotinylated

This Recombinant Human Testis-expressed protein 53 (TEX53), Biotinylated spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 53 TEX53

UniProt

A0A1B0GU33

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSKIFCCCRKTSEGSSTTVGFHNPRMFEQHHPRSFNLNTNSLHSAVPKRHPRLPYDNRMMLKACILRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diclofenac Dimer Impurity
TRC-D436455-2.5MG 2.5 mg

Diclofenac Dimer Impurity

Sign In for Pricing
View Details
Recombinant Human CRTAM /CD355 Protein (His Tag)
PKSH032286-01 10 µg

Recombinant Human CRTAM /CD355 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CRTAM /CD355 Protein (His Tag)
PKSH032286-02 50 µg

Recombinant Human CRTAM /CD355 Protein (His Tag)

Sign In for Pricing
View Details
beta II Tubulin (TUBB2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H3]
TA506597AM 100 µL

beta II Tubulin (TUBB2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H3]

Sign In for Pricing
View Details
GRAP2 Antibody
KC-7127-01 50 μL

GRAP2 Antibody

Sign In for Pricing
View Details
GRAP2 Antibody
KC-7127-02 100 µL

GRAP2 Antibody

Sign In for Pricing
View Details