Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CFAP97D2 (C97D2), Biotinylated

This Recombinant Human Uncharacterized protein CFAP97D2 (C97D2), Biotinylated spans the amino acid sequence from region 1-98. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CFAP97D2; CFAP97 domain-containing protein 2; CFAP97D2

UniProt

A0A1B0GU71

Expression Region

1-98

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MHGAPRLTFPCASEYLWHAREKAYQDHRRKVQSAQPLVDTRAPLTFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRGQTDSKNNSKHRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX3 Recombinant Antibody, Biotin Conjugated
bsm-62240R-Biotin 100 µL

TBX3 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
TruStrip RDT Rabbit IgG Rapid Test cards, 10/pk
6520-RDT-10 1 Pk

TruStrip RDT Rabbit IgG Rapid Test cards, 10/pk

Sign In for Pricing
View Details
Anti-TRIM13 Antibody Picoband®
A07862-1 100 µg/Vial

Anti-TRIM13 Antibody Picoband®

Sign In for Pricing
View Details
FUT3 Human shRNA Plasmid Kit (Locus ID 2525)
TL312898 1 Kit

FUT3 Human shRNA Plasmid Kit (Locus ID 2525)

Sign In for Pricing
View Details
Sodium 2,2-difluorohexanoate
PC450242 1 Each

Sodium 2,2-difluorohexanoate

Sign In for Pricing
View Details
Recombinant NCR3/CD337 Monoclonal Antibody
AN300339P 100 µL

Recombinant NCR3/CD337 Monoclonal Antibody

Sign In for Pricing
View Details