Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C17orf114 (CQ114), Biotinylated

This Recombinant Human Uncharacterized protein C17orf114 (CQ114), Biotinylated spans the amino acid sequence from region 1-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C17orf114 C17orf114

UniProt

A0A1B0GUV1

Expression Region

1-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGLKGAWCFPWCGCRRQRGTERGAGLSPAAPPDPSPAIAPTMAEGGVPSPGPGAYFSRKARLSFRHQLHDIASANDSTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shewanella baltica Chaperone protein hscA homolog (hscA), partial
MBS1238424 Inquire

Recombinant Shewanella baltica Chaperone protein hscA homolog (hscA), partial

Sign In for Pricing
View Details
YAF2 (YY1 Associated Factor 2, MGC41856)
253496 50 µg

YAF2 (YY1 Associated Factor 2, MGC41856)

Sign In for Pricing
View Details
2-Hexyl-2- (hydroxymethyl) propane-1,3-diol
JH918479 1 Each

2-Hexyl-2- (hydroxymethyl) propane-1,3-diol

Sign In for Pricing
View Details
Phospho-FAK (Y397) Rabbit pAb
E2381143 100 µL

Phospho-FAK (Y397) Rabbit pAb

Sign In for Pricing
View Details
Influenza A Nucleoprotein Recombinant Protein
orb1671340 0.1 mg

Influenza A Nucleoprotein Recombinant Protein

Sign In for Pricing
View Details
Mouse AFG3-like protein 2, Afg3l2 ELISA KIT
ELI-24826m 96 Tests

Mouse AFG3-like protein 2, Afg3l2 ELISA KIT

Sign In for Pricing
View Details