Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CHD9 neighbor protein (CHD9N), Biotinylated

This Recombinant Human CHD9 neighbor protein (CHD9N), Biotinylated spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHD9 neighbor protein CHD9NB

UniProt

A0A1B0GV96

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCHSSKSTTVAAESQKLEEEREGREPGLETGTQAADCKDAPLKDGTPEPKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF169 3'UTR GFP Stable Cell Line
TU079011 1.0 mL

ZNF169 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human ANKRD60 Pre-designed siRNA Set A
SI000741A 1 Each

Human ANKRD60 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CSNK2A1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV665194 1.0 µg DNA

CSNK2A1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody [Clone 1F5]
E45M16786V-2 50 µL

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody [Clone 1F5]

Sign In for Pricing
View Details
Tbcel Mouse shRNA Plasmid (Locus ID 272589)
TL508146 1 Kit

Tbcel Mouse shRNA Plasmid (Locus ID 272589)

Sign In for Pricing
View Details
KBTBD7, ID (KBTBD7, Kelch repeat and BTB domain-containing protein 7) (Biotin) discontinued
037281-Biotin 200 µL

KBTBD7, ID (KBTBD7, Kelch repeat and BTB domain-containing protein 7) (Biotin) discontinued

Sign In for Pricing
View Details