Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54), Biotinylated

This Recombinant Human Testis-expressed protein 54 (TEX54), Biotinylated spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS501283 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human TMEM121B activation kit by CRISPRa
GA109150 1 Kit

Human TMEM121B activation kit by CRISPRa

Sign In for Pricing
View Details
Siah3 Mouse Gene Knockout Kit (CRISPR)
KN515773 1 Kit

Siah3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF488A conjugate, 0.1mg/mL
BNC880844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Kallikrein 9 (KLK9) (NM_012315) Human Recombinant Protein
TP320945 20 µg

Kallikrein 9 (KLK9) (NM_012315) Human Recombinant Protein

Sign In for Pricing
View Details
Annexin V, CF®647 Conjugate
#29003 1x 500 µL

Annexin V, CF®647 Conjugate

Sign In for Pricing
View Details