Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54), Biotinylated

This Recombinant Human Testis-expressed protein 54 (TEX54), Biotinylated spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gallotannin
sc-202619D 1 Kg

Gallotannin

Sign In for Pricing
View Details
Recombinant Litoria rubella Rubellidin-3.2
MBS1242127-01 0.05 mg (E-Coli)

Recombinant Litoria rubella Rubellidin-3.2

Sign In for Pricing
View Details
Recombinant Litoria rubella Rubellidin-3.2
MBS1242127-02 0.2 mg (E-Coli)

Recombinant Litoria rubella Rubellidin-3.2

Sign In for Pricing
View Details
Recombinant Litoria rubella Rubellidin-3.2
MBS1242127-03 0.5 mg (E-Coli)

Recombinant Litoria rubella Rubellidin-3.2

Sign In for Pricing
View Details
Recombinant Litoria rubella Rubellidin-3.2
MBS1242127-04 0.05 mg (Yeast)

Recombinant Litoria rubella Rubellidin-3.2

Sign In for Pricing
View Details
Recombinant Litoria rubella Rubellidin-3.2
MBS1242127-05 0.05 mg (Baculovirus)

Recombinant Litoria rubella Rubellidin-3.2

Sign In for Pricing
View Details