Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IQ domain-containing protein M (IQCM), Biotinylated

This Recombinant Human IQ domain-containing protein M (IQCM), Biotinylated spans the amino acid sequence from region 1-501. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IQ domain-containing protein M IQCM

UniProt

A0A1B0GVH7

Expression Region

1-501

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTTEEAMPEKAKCPTLEITKQDFFQEAKTLIAQHYEKINENKVQGTSINVFRKKHQKPKSGKYIPLEIDKKVTRDVVQEHRAALRRICFPKELSKSEHLQEPPQRISFKEPHIFSRRERCRPIDLITKGQVKLDKIMTIIEPVSKKMETAKQQHFEESRNRMLELLYPFPVHLYLQPGTSNLELLKEPDKAFYDWRGFVLTRSFRLACDSRRVSFSQSSSIFRDYYSKTFKTLIKKERQPIKPEPKSQPRIKGTPNKTDKLDSKVKRIGPHIEIFQVFRERKKFMITPKLIRMVTVMQAHVRGWLERKRLQRVMTKALDHGPDMKAVINMYGRLIHRVRYRRGLWRTRQILNLAELEEWMDRKKFYEIMFAKREDWPKIERNELPNFFSDCGHFPTQKQVDDTWDLVHQDGKEKYSELIKKSKAIEMLFTLYPPEGAHVPDSTLLKSTWLRPIVNGEEGYRYIVNGHPALKRANIRVVGKLVARSIRERKMRQHYKSCKVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Protein bassoon (BSN) ELISA Kit
abx516015 96 Well

Rat Protein bassoon (BSN) ELISA Kit

Sign In for Pricing
View Details
PLGF Polyclonal Antibody, RBITC Conjugated
bs-0234R-RBITC 100 µL

PLGF Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
FAM156A (NM_014138) Human Recombinant Protein
TP309811 20 µg

FAM156A (NM_014138) Human Recombinant Protein

Sign In for Pricing
View Details
Angiotensin II Type 1 Receptor Rabbit Polyclonal Antibody (PerCP)
orb2458367 100 µL

Angiotensin II Type 1 Receptor Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Olr25 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV631558 1.0 µg DNA

Olr25 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
C3orf55 (PQLC2L) Human Over-expression Lysate
orb1361281 20 µg

C3orf55 (PQLC2L) Human Over-expression Lysate

Sign In for Pricing
View Details