Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Embryonic testis differentiation protein homolog C (ETDC), Biotinylated

This Recombinant Human Embryonic testis differentiation protein homolog C (ETDC), Biotinylated spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Embryonic testis differentiation protein homolog C ETDC

UniProt

A0A1B0GVM5

Expression Region

1-59

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDKELPKASPSEPALNIKKSGKSFKCKKPTKNVQVFLINRQLGRNRSDTDLSKWLWMLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) RIX1 Polyclonal Antibody
MBS7155546 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) RIX1 Polyclonal Antibody

Sign In for Pricing
View Details
SPRED1 Protein Vector (Human) (pPB-N-His)
PV133199 500 ng

SPRED1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Anti-UHMK1 antibody
STJ71928 100 µg

Anti-UHMK1 antibody

Sign In for Pricing
View Details
Human a disintegrin and metalloproteinase with thrombospondin motifs 1 (ADAMTS1) ELISA Kit
GA-E1172HM-01 48 Tests

Human a disintegrin and metalloproteinase with thrombospondin motifs 1 (ADAMTS1) ELISA Kit

Sign In for Pricing
View Details
Human a disintegrin and metalloproteinase with thrombospondin motifs 1 (ADAMTS1) ELISA Kit
GA-E1172HM-02 96 Tests

Human a disintegrin and metalloproteinase with thrombospondin motifs 1 (ADAMTS1) ELISA Kit

Sign In for Pricing
View Details
Anti-ABCA3 antibody
STJ28942 100 µl

Anti-ABCA3 antibody

Sign In for Pricing
View Details