Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 200 (CC200), Biotinylated

This Recombinant Human Coiled-coil domain-containing protein 200 (CC200), Biotinylated spans the amino acid sequence from region 1-168. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 200 CCDC200

UniProt

A0A1B0GVQ3

Expression Region

1-168

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSAYHWEARRRQMALDRRRWLMAQQQQELQQKEQELKNHQEEEQQSEEKLQPHKKLNVPQPPVAKLWTSQEQPQPSQQQPSVQPPSQPPPQPSTLPQAQVWPGPQPPQPQPPPQPTQPSAQARCTQHTSKCNLQDSQRPGLMNPCQSSPIRNTGYSQLKSTNYIQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HECTD3 Human Gene Knockout Kit (CRISPR)
KN420357 1 Kit

HECTD3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARHGAP25 Human Gene Knockout Kit (CRISPR)
KN417414 1 Kit

ARHGAP25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/1210), CF488A conjugate, 0.1mg/mL
BNC881210-100 1x 100 µL

CD163 (Monocyte & Macrophage Marker) (M130/1210), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1d Mouse Gene Knockout Kit (CRISPR)
KN502339 1 Kit

C1d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ALDH1A1 Rabbit Polyclonal Antibody
R1706-2 100 µL

ALDH1A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant HSPA1A Antibody
RC-6662-01 50 μL

Recombinant HSPA1A Antibody

Sign In for Pricing
View Details