Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM240C (F240C), Biotinylated

This Recombinant Human Protein FAM240C (F240C), Biotinylated spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM240C FAM240C

UniProt

A0A1B0GVR7

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVGKNMSKSLTLKNPGRVAYDSGGIKMFWEKKIEHHARHLQNEDIRVRRSALNKLRVGWAEQLEGRNKMLQGPGRCPDRVPEATESLHTKDKKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNRD2 Recombinant Rabbit Monoclonal Antibody [PSH02-26]
HA721806 100 µL

TXNRD2 Recombinant Rabbit Monoclonal Antibody [PSH02-26]

Sign In for Pricing
View Details
ReadiLink™ Rapid iFluor® 750 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*
1250-AAT 2 Labelings

ReadiLink™ Rapid iFluor® 750 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*

Sign In for Pricing
View Details
GJB6 (NM_001110221) Human Over-expression Lysate
LC426318 20 µg

GJB6 (NM_001110221) Human Over-expression Lysate

Sign In for Pricing
View Details
BrdU (Bromodeoxyuridine) (BRD.3), 0.2mg/mL
BNUB0885-100 1x 100 µL

BrdU (Bromodeoxyuridine) (BRD.3), 0.2mg/mL

Sign In for Pricing
View Details
EXOSC3 (NM_001002269) Human Over-expression Lysate
LC424199 20 µg

EXOSC3 (NM_001002269) Human Over-expression Lysate

Sign In for Pricing
View Details
Npc2 (NM_023409) Mouse Tagged ORF Clone
MG201050 10 µg

Npc2 (NM_023409) Mouse Tagged ORF Clone

Sign In for Pricing
View Details