Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 36 (SIM36), partial, Biotinylated

This Recombinant Human Small integral membrane protein 36 (SIM36), partial, Biotinylated spans the amino acid sequence from region 35-93. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 36 SMIM36

UniProt

A0A1B0GVT2

Expression Region

35-93

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDCRGKDPSKEYAPEATLEAQPSIRLVVMHPSVAGPHWPKGPGLSLGDPAPLGKKSTMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), 0.2mg/mL
BNUB1798-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), 0.2mg/mL

Sign In for Pricing
View Details
Hsp75 (TRAP1) Human Gene Knockout Kit (CRISPR)
KN203439BN 1 Kit

Hsp75 (TRAP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS700342 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Human HIC1 activation kit by CRISPRa
GA102106 1 Kit

Human HIC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Histone H3 (mono methyl K27) Recombinant Rabbit monoclonal Antibody
HA751019 100 µL

Histone H3 (mono methyl K27) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Alpha Tubulin Monoclonal Antibody
E-AB-48012-01 25 µL

Alpha Tubulin Monoclonal Antibody

Sign In for Pricing
View Details