Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM240B (F240B), Biotinylated

This Recombinant Human Protein FAM240B (F240B), Biotinylated spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM240B FAM240B

UniProt

A0A1B0GVZ2

Expression Region

1-78

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNNQYIRREVFCCGTCHELKSFWEKEISKQTFYRELEEDRQERSALKKLREEWRQRLERRLRMLDNPVEKEKPAHTAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAH11 (Dynein, Axonemal, Heavy Chain 11)
053139 200 µL

DNAH11 (Dynein, Axonemal, Heavy Chain 11)

Sign In for Pricing
View Details
RIN1 Polyclonal Antibody, FITC Conjugated
A68697-100 100 µL

RIN1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
TTR Antibody
orb1247074 0.1 mg

TTR Antibody

Sign In for Pricing
View Details
Cat Parathyroid Hormone/Parathyroid Hormone-Related Peptide Receptor (PTH1R) ELISA Kit
MBS9355738 Inquire

Cat Parathyroid Hormone/Parathyroid Hormone-Related Peptide Receptor (PTH1R) ELISA Kit

Sign In for Pricing
View Details
Brp16 Polyclonal Antibody
orb1414536 100 µL

Brp16 Polyclonal Antibody

Sign In for Pricing
View Details
Notch1a (Neurogenic Locus Notch Homolog Protein 1, Notch)
N5375-12A 100 µg

Notch1a (Neurogenic Locus Notch Homolog Protein 1, Notch)

Sign In for Pricing
View Details