Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 269 (TM269), partial, Biotinylated

This Recombinant Human Transmembrane protein 269 (TM269), partial, Biotinylated spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 269 TMEM269

UniProt

A0A1B0GVZ9

Expression Region

1-59

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVLGLFSIIFSFSRKCHYASRMLLVSFLLDMAVRAMTSHINICSKLGAELNDFAVFTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cow Inter-Alpha-Trypsin Inhibitor Heavy Chain H3 (ITIH3) ELISA Kit
abx516553 96 Tests

Cow Inter-Alpha-Trypsin Inhibitor Heavy Chain H3 (ITIH3) ELISA Kit

Sign In for Pricing
View Details
Mouse Axl Alexa Fluor 488 MAb (Clone 175128)
FAB8541G-025UG 25 µg

Mouse Axl Alexa Fluor 488 MAb (Clone 175128)

Sign In for Pricing
View Details
FAM91A1 Rabbit Polyclonal Antibody
E10G06500 100 µL

FAM91A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF93 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-13558R-PE-Cy5.5 100 µL

ZNF93 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Cyclophilin B (PPIB) (NM_000942) Human Tagged ORF Clone Lentiviral Particle
RC203180L2V 200 µL

Cyclophilin B (PPIB) (NM_000942) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3,3,5-Triiodo-L-Thyronine extrapure, 95%
35241-01 100 mg

3,3,5-Triiodo-L-Thyronine extrapure, 95%

Sign In for Pricing
View Details