Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 41 (SIM41), partial, Biotinylated

This Recombinant Human Small integral membrane protein 41 (SIM41), partial, Biotinylated spans the amino acid sequence from region 1-37. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 41 SMIM41

UniProt

A0A2R8YCJ5

Expression Region

1-37

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNGSQAGAAAQAAWLSSCCNQSASPPEPPEGPRAVQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit
RDR-NTXI-Ra-01 96 Tests

Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit
RDR-NTXI-Ra-02 48 Tests

Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS625168 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
HTR2C Rabbit Monoclonal Antibody
TA423181 100 µL

HTR2C Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Vacuum Oven BOVA-7501
BOVA-7501 1 Unit

Vacuum Oven BOVA-7501

Sign In for Pricing
View Details
S100A4 Human Gene Knockout Kit (CRISPR)
KN201616RB 1 Kit

S100A4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details