Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ), Biotinylated

This Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ), Biotinylated spans the amino acid sequence from region 16-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secretory calcium-binding phosphoprotein proline-glutamine rich 1 SCPPPQ1

UniProt

A0A411D538

Expression Region

16-79

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LPIPLEQYAESSSEQRFIFYPPQVPPFFPQVLFPLPPQPPLVLTPNDLIALLIAILNQLGILFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klhl21 (NM_001033352) Mouse Tagged ORF Clone
MG218868 10 µg

Klhl21 (NM_001033352) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Histone Acetyltransferase 1 (HAT1) Antibody
abx172825-01 200 µg

Histone Acetyltransferase 1 (HAT1) Antibody

Sign In for Pricing
View Details
Histone Acetyltransferase 1 (HAT1) Antibody
abx172825-02 1 mg

Histone Acetyltransferase 1 (HAT1) Antibody

Sign In for Pricing
View Details
NUF2 Antibody - N-terminal region
ARP72640_P050-25UL 25 µL

NUF2 Antibody - N-terminal region

Sign In for Pricing
View Details
1-Phenyl-4-pentyn-1-one
TAA47665-01 50 mg

1-Phenyl-4-pentyn-1-one

Sign In for Pricing
View Details
1-Phenyl-4-pentyn-1-one
TAA47665-02 0.5 g

1-Phenyl-4-pentyn-1-one

Sign In for Pricing
View Details