Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell receptor gamma alternate reading frame protein (TARP), Biotinylated

This Recombinant Human T-cell receptor gamma alternate reading frame protein (TARP), Biotinylated spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell receptor gamma alternate reading frame protein; TARP; TRGC1

UniProt

A2JGV3

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQMFPPSPLFFFLQLLKQSSRRLEHTFVFLRNFSLMLLRYIGKKRRATRFWDPRRGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-500 1x 500 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF640R conjugate, 0.1mg/mL
BNC401893-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF568 conjugate, 0.1mg/mL
BNC682266-500 1x 500 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details