Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell receptor gamma alternate reading frame protein (TARP), Biotinylated

This Recombinant Human T-cell receptor gamma alternate reading frame protein (TARP), Biotinylated spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell receptor gamma alternate reading frame protein; TARP; TRGC1

UniProt

A2JGV3

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQMFPPSPLFFFLQLLKQSSRRLEHTFVFLRNFSLMLLRYIGKKRRATRFWDPRRGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP4 Rabbit Polyclonal Antibody
54277-01 50 µL

PARP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PARP4 Rabbit Polyclonal Antibody
54277-02 100 µL

PARP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DDX55
522214-01 100 µL

DDX55

Sign In for Pricing
View Details
DDX55
522214-02 200 µL

DDX55

Sign In for Pricing
View Details
BMP2 Antibody
orb1268723 400 μl

BMP2 Antibody

Sign In for Pricing
View Details
TRBP2 (D-5) Alexa Fluor® 546
sc-514124 AF546 200 µg/mL

TRBP2 (D-5) Alexa Fluor® 546

Sign In for Pricing
View Details