Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LMO7 downstream neighbor protein (LMO7D), Biotinylated

This Recombinant Human LMO7 downstream neighbor protein (LMO7D), Biotinylated spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LMO7 downstream neighbor protein LMO7DN C13orf45

UniProt

F2Z398

Expression Region

1-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHALSPRLECSGTFSAHCILGLPGGSSYPPASVSQVVGTTALYLVEEAWAEAGKMRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM26 shRNA Plasmid (m)
sc-76745-SH 20 µg

TRIM26 shRNA Plasmid (m)

Sign In for Pricing
View Details
Mouse Pcdh18 qPCR Primer Pair
QM41842S 200 Tests

Mouse Pcdh18 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse chondroitin sulfate,CS Elisa Kit
EK730092 96 Well

Mouse chondroitin sulfate,CS Elisa Kit

Sign In for Pricing
View Details
Human mucin-5 subtype B, MUC5B ELISA Kit
MBS704534-01 24 Well (LIMIT 1)

Human mucin-5 subtype B, MUC5B ELISA Kit

Sign In for Pricing
View Details
Human mucin-5 subtype B, MUC5B ELISA Kit
MBS704534-02 48 Well

Human mucin-5 subtype B, MUC5B ELISA Kit

Sign In for Pricing
View Details
Human mucin-5 subtype B, MUC5B ELISA Kit
MBS704534-03 96 Well

Human mucin-5 subtype B, MUC5B ELISA Kit

Sign In for Pricing
View Details